PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00039250-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 850aa    MW: 95421 Da    PI: 5.7274
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00039250-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.41.3e-934067411355
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+++d++ a+++L++++ +as +gd +qRla yf+ AL arl++s+ +l+ +l++  ts    ++ l+a++l+  ++P+ k 
  PSME_00039250-RA 406 LRALLVHCAQAVATDDTRGANEILKQIRRHASAYGDGTQRLANYFADALVARLSGSGGRLFTTLSSGLTS---AADILKAYQLLLFAFPYQKS 495
                       5789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                        ++++Nq++l+ +e+++r+Hi+Df+i +G+QWp+L+ +LasRp+                ++ e+eetg+rLa++A+++gvpfe+++ +a ++
  PSME_00039250-RA 496 FYFLTNQTVLNVTEKSNRLHIVDFGILYGFQWPSLILSLASRPAA---------------ERIEIEETGRRLADYAKSFGVPFEYHA-IAAKW 572
                       ******************************************876...............5689***********************.799** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       e++++eeL+++++E+l+Vn++++  +llde+v les+++ vL+ ++s++P+v+++   +   n++ F +rf eal +ysalfd++e+ +pre+
  PSME_00039250-RA 573 ENVDVEELSLRSDEVLVVNCMYRFNNLLDETVVLESPKNIVLNKIRSMNPRVFIHGVVNGAFNAPFFITRFREALFHYSALFDAIETIVPREH 665
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                        +r  +E+el+gr i nvvaceg er+ r et+++W+ r+++aGF ++pl+  + ++ +  ++ +  + + v+e++
  PSME_00039250-RA 666 PQRLLLEKELFGRLILNVVACEGLERVVRPETYKHWQVRIQRAGFVQLPLDRAIFSETRDKVKSFFHKDFGVDEDE 741
                       ****************************************************************998889999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.371380740IPR005202Transcription factor GRAS
PfamPF035144.5E-91406741IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MADEKTGIFH SNNINVVSNN IRLQRPCLQQ GAAMPATQFR RFQPPMPDEK TGIFYSDNIN  60
GVSNNIWLQR PWLQQETAMP ATQFRGSLSS QKSITISDGE SEDTEVYSDI VLKYISDMLM  120
EENMDEKKCM YQECSALQAT VKPFYDILGE NYPPQGLCNS NTVGENQKQP LNYYEDDVQI  180
KIEDSSWIGD FFNSQMPEGF ESPLSPNLSA GYSSRYSFSY SGSSTVTDGL PGSPTYEPSL  240
SESKQGLEVG KFEEDIQVVP KQNFEPGVEN GCHFRAPKKV SDPDPDLQLG KREDAIFGVG  300
VTFQMNAAHR EDENGPKREK DPHRGDLDLE DRDSNKLSAV YPDNVIRNES FDKVLLCAEN  360
GRVFLDVQLE ILQNGVQKSV QSGFVKGLQG SKARGRKQGK RAVVDLRALL VHCAQAVATD  420
DTRGANEILK QIRRHASAYG DGTQRLANYF ADALVARLSG SGGRLFTTLS SGLTSAADIL  480
KAYQLLLFAF PYQKSFYFLT NQTVLNVTEK SNRLHIVDFG ILYGFQWPSL ILSLASRPAA  540
ERIEIEETGR RLADYAKSFG VPFEYHAIAA KWENVDVEEL SLRSDEVLVV NCMYRFNNLL  600
DETVVLESPK NIVLNKIRSM NPRVFIHGVV NGAFNAPFFI TRFREALFHY SALFDAIETI  660
VPREHPQRLL LEKELFGRLI LNVVACEGLE RVVRPETYKH WQVRIQRAGF VQLPLDRAIF  720
SETRDKVKSF FHKDFGVDED ECSTYAARPN PWKASEDKGG PLQVVIKVFF FAQDPDCPGF  780
SLLFPEPVSV SLLSLVGATS LGQVVKIFSS TSEFPRALSF GLARMLSTAL ASGTFPFHLR  840
WSRCTLRNLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-404107158328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937596.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010937597.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein